Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50005292 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1295421 (CHEMBL3131058) |
---|
Ki | 0.79±n/a nM |
---|
Citation | Médran-Navarrete, V; Damont, A; Peyronneau, MA; Kuhnast, B; Bernards, N; Pottier, G; Marguet, F; Puech, F; Boisgard, R; Dollé, F Preparation and evaluation of novel pyrazolo[1,5-a]pyrimidine acetamides, closely related to DPA-714, as potent ligands for imaging the TSPO 18kDa with PET. Bioorg Med Chem Lett24:1550-6 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50005292 |
---|
n/a |
---|
Name | BDBM50005292 |
Synonyms: | CHEMBL3125364 |
Type | Small organic molecule |
Emp. Form. | C26H31FN4O |
Mol. Mass. | 434.5489 |
SMILES | CCN(CC)C(=O)Cc1c(nn2c(C)cc(C)nc12)-c1ccc(cc1)C#CCCCCF |
Structure |
|