| Reaction Details |
|---|
 | Report a problem with these data |
| Target | G-protein coupled bile acid receptor 1 |
|---|
| Ligand | BDBM50003559 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1335565 (CHEMBL3239420) |
|---|
| EC50 | 1.000000±n/a nM |
|---|
| Citation |  Phillips, DP; Gao, W; Yang, Y; Zhang, G; Lerario, IK; Lau, TL; Jiang, J; Wang, X; Nguyen, DG; Bhat, BG; Trotter, C; Sullivan, H; Welzel, G; Landry, J; Chen, Y; Joseph, SB; Li, C; Gordon, WP; Richmond, W; Johnson, K; Bretz, A; Bursulaya, B; Pan, S; McNamara, P; Seidel, HM Discovery of trifluoromethyl(pyrimidin-2-yl)azetidine-2-carboxamides as potent, orally bioavailable TGR5 (GPBAR1) agonists: structure-activity relationships, lead optimization, and chronic in vivo efficacy. J Med Chem57:3263-82 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| G-protein coupled bile acid receptor 1 |
|---|
| Name: | G-protein coupled bile acid receptor 1 |
|---|
| Synonyms: | BG37 | GPBAR1 | GPBAR_HUMAN | M-BAR | TGR5 | hBG37 | hGPCR19 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 35260.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | CHO cells transiently transfected with hTGR5. |
|---|
| Residue: | 330 |
|---|
| Sequence: | MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
|
|
|
|---|
| BDBM50003559 |
|---|
| n/a |
|---|
| Name | BDBM50003559 |
|---|
| Synonyms: | CHEMBL3234570 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H32F3N7O2 |
|---|
| Mol. Mass. | 543.5839 |
|---|
| SMILES | FC(F)(F)c1nc(cc(n1)N1CCC[C@H](C1)C(=O)NCCc1ccc(cc1)C#N)N1CCN(CC1)C1COC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
