Reaction Details |
| Report a problem with these data |
Target | Induced myeloid leukemia cell differentiation protein Mcl-1 |
---|
Ligand | BDBM71455 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1349703 (CHEMBL3266887) |
---|
IC50 | 7170±n/a nM |
---|
Citation | Abulwerdi, FA; Liao, C; Mady, AS; Gavin, J; Shen, C; Cierpicki, T; Stuckey, JA; Showalter, HD; Nikolovska-Coleska, Z 3-Substituted-N-(4-hydroxynaphthalen-1-yl)arylsulfonamides as a novel class of selective Mcl-1 inhibitors: structure-based design, synthesis, SAR, and biological evaluation. J Med Chem57:4111-33 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Induced myeloid leukemia cell differentiation protein Mcl-1 |
---|
Name: | Induced myeloid leukemia cell differentiation protein Mcl-1 |
Synonyms: | BCL2L3 | Bcl-2-like protein 3 | Bcl-2-like protein 3 (Mcl-1) | Bcl-2-related protein EAT/mcl1 | Bcl2-L-3 | Induced myeloid leukemia cell differentiation protein (Mcl-1) | MCL1 | MCL1_HUMAN | Mcl-1 | Myeloid Cell factor-1 (Mcl-1) | Myeloid cell leukemia sequence 1 (BCL2-related) | mcl1/EAT |
Type: | Membrane; Single-pass membrane protein |
Mol. Mass.: | 37332.87 |
Organism: | Homo sapiens (Human) |
Description: | Q07820 |
Residue: | 350 |
Sequence: | MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
|
|
|
BDBM71455 |
---|
n/a |
---|
Name | BDBM71455 |
Synonyms: | 2-[1-hydroxy-4-[(4-methoxyphenyl)sulfonylamino]naphthalen-2-yl]sulfanylacetic acid | 2-[4-[(4-methoxyphenyl)sulfonylamino]-1-oxidanyl-naphthalen-2-yl]sulfanylethanoic acid | 2-[[1-hydroxy-4-[(4-methoxyphenyl)sulfonylamino]-2-naphthalenyl]thio]acetic acid | 2-[[1-hydroxy-4-[(4-methoxyphenyl)sulfonylamino]-2-naphthyl]thio]acetic acid | MLS001196210 | SMR000558498 | [(1-hydroxy-4-{[(4-methoxyphenyl)sulfonyl]amino}-2-naphthyl)thio]acetic acid | cid_2058961 |
Type | Small organic molecule |
Emp. Form. | C19H17NO6S2 |
Mol. Mass. | 419.471 |
SMILES | COc1ccc(cc1)S(=O)(=O)Nc1cc(SCC(O)=O)c(O)c2ccccc12 |
Structure |
|