Reaction Details |
| Report a problem with these data |
Target | Bcl-2-related protein A1 |
---|
Ligand | BDBM50013867 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1349699 (CHEMBL3266883) |
---|
Ki | 3360±n/a nM |
---|
Citation | Abulwerdi, FA; Liao, C; Mady, AS; Gavin, J; Shen, C; Cierpicki, T; Stuckey, JA; Showalter, HD; Nikolovska-Coleska, Z 3-Substituted-N-(4-hydroxynaphthalen-1-yl)arylsulfonamides as a novel class of selective Mcl-1 inhibitors: structure-based design, synthesis, SAR, and biological evaluation. J Med Chem57:4111-33 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bcl-2-related protein A1 |
---|
Name: | Bcl-2-related protein A1 |
Synonyms: | B2LA1_HUMAN | BCL2A1 | BCL2L5 | BFL1 | Bcl-2-like protein 5 | GRS | HBPA1 | Hemopoietic-specific early response protein | Protein BFL-1 | Protein GRS |
Type: | Apoptosis regulator protein |
Mol. Mass.: | 20130.01 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 175 |
Sequence: | MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVN
VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISY
FVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
|
|
|
BDBM50013867 |
---|
n/a |
---|
Name | BDBM50013867 |
Synonyms: | CHEMBL3265299 |
Type | Small organic molecule |
Emp. Form. | C24H19NO6S2 |
Mol. Mass. | 481.541 |
SMILES | OC(=O)CSc1cc(NS(=O)(=O)c2ccc(Oc3ccccc3)cc2)c2ccccc2c1O |
Structure |
|