| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Elongin-C |
|---|
| Ligand | BDBM50446134 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1350285 (CHEMBL3267623) |
|---|
| Kd | 10000000±n/a nM |
|---|
| Citation |  Guo, W; Wisniewski, JA; Ji, H Hot spot-based design of small-molecule inhibitors for protein-protein interactions. Bioorg Med Chem Lett24:2546-54 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Elongin-C |
|---|
| Name: | Elongin-C |
|---|
| Synonyms: | ELOC | ELOC_HUMAN | Elongin 15 kDa subunit | Elongin-C | RNA polymerase II transcription factor SIII subunit C | SIII p15 | TCEB1 | Transcription elongation factor B polypeptide 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 12466.49 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_108414 |
|---|
| Residue: | 112 |
|---|
| Sequence: | MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV
NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
|
|
|
|---|
| BDBM50446134 |
|---|
| n/a |
|---|
| Name | BDBM50446134 |
|---|
| Synonyms: | CHEMBL3108877 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C8H14N2O3 |
|---|
| Mol. Mass. | 186.2084 |
|---|
| SMILES | CNC(=O)[C@@H]1C[C@@H](O)CN1C(C)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
