Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPorphobilinogen synthase
LigandBDBM50017185
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1365601
EC50 19000±n/a nM
Citation Lentz CSHalls VSHannam JSStrassel SLawrence SHJaffe EKFamulok MHoerauf APfarr KM wALADin benzimidazoles differentially modulate the function of porphobilinogen synthase orthologs. J Med Chem 57:2498-510 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Porphobilinogen synthase
Name:Porphobilinogen synthase
Synonyms:n/a
Type:Enzyme
Mol. Mass.:35617.37
Organism:Escherichia coli
Description:P0ACB2
Residue:324
Sequence:
MTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEAMPGVMRIPEKH
LAREIERIANAGIRSVMTFGISHHTDETGSDAWREDGLVARMSRICKQTVPEMIVMSDTC
FCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFKDTAIMSYSTKFASSFYGPFREAAGSALKGDRKSYQMNPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDIVRELRERTELPIGAYQVSGEYAMIKFAALAGAIDEEKVVLESLGS
IKRAGADLIFSYFALDLAEKKILR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50017185
n/a
NameBDBM50017185
Synonyms:CHEMBL3287361
TypeSmall organic molecule
Emp. Form.C23H18F3N3O3S
Mol. Mass.473.468
SMILESOC(=O)c1cccc2n(Cc3cccc(c3)C(F)(F)F)c(CCNC(=O)c3cccs3)nc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: