| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E synthase |
|---|
| Ligand | BDBM50017961 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1365207 (CHEMBL3292957) |
|---|
| IC50 | 4160±n/a nM |
|---|
| Citation |  Lauro, G; Strocchia, M; Terracciano, S; Bruno, I; Fischer, K; Pergola, C; Werz, O; Riccio, R; Bifulco, G Exploration of the dihydropyrimidine scaffold for the development of new potential anti-inflammatory agents blocking prostaglandin E2 synthase-1 enzyme (mPGES-1). Eur J Med Chem80:407-15 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E synthase |
|---|
| Name: | Prostaglandin E synthase |
|---|
| Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17112.22 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 152 |
|---|
| Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
|---|
| BDBM50017961 |
|---|
| n/a |
|---|
| Name | BDBM50017961 |
|---|
| Synonyms: | CHEMBL3289346 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H21F3N2O6 |
|---|
| Mol. Mass. | 514.4499 |
|---|
| SMILES | CCOC(=O)C1=C([C@@H](NC(=O)N1)c1ccc(o1)-c1cccc(c1)C(F)(F)F)C(=O)c1ccc(OC)cc1 |r,t:5| |
|---|
| Structure | 
|
|---|
Search and Browse
