Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAccessory gene regulator protein A
LigandBDBM11318
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1366621
IC50 17100±n/a nM
Citation Figueroa MJarmusch AKRaja HAEl-Elimat TKavanaugh JSHorswill ARCooks RGCech NBOberlies NH Polyhydroxyanthraquinones as quorum sensing inhibitors from the guttates of Penicillium restrictum and their analysis by desorption electrospray ionization mass spectrometry. J Nat Prod 77:1351-8 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Accessory gene regulator protein A
Name:Accessory gene regulator protein A
Synonyms:agr | agrA
Type:PROTEIN
Mol. Mass.:27903.57
Organism:Staphylococcus aureus
Description:ChEMBL_1366621
Residue:238
Sequence:
MKIFICEDDPKQRENMVTIIKNYIMIEEKPMEIALATDNPYEVLEQAKNMNDIGCYFLDI
QLSTDINGIKLGSEIRKHDPVGNIIFVTSHSELTYLTFVYKVAAMDFIFKDDPAELRTRI
IDCLETAHTRLQLLSKDNSVETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQI
EFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11318
n/a
NameBDBM11318
Synonyms:1,3,8-trihydroxy-6-methyl-9,10-dihydroanthracene-9,10-dione | 1,3,8-trihydroxy-6-methylanthra-9,10-quinone | CHEMBL289277 | Emodin
TypeSmall organic molecule
Emp. Form.C15H10O5
Mol. Mass.270.2369
SMILESCc1cc(O)c2C(=O)c3c(O)cc(O)cc3C(=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: