Reaction Details |
| Report a problem with these data |
Target | Tumor necrosis factor |
---|
Ligand | BDBM50373071 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1363479 (CHEMBL3291701) |
---|
Kd | 3.81±n/a nM |
---|
Citation | Chen, L; Du, J; Dai, Q; Zhang, H; Pang, W; Hu, J Prediction of anti-tumor chemical probes of a traditional Chinese medicine formula by HPLC fingerprinting combined with molecular docking. Eur J Med Chem83:294-306 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Tumor necrosis factor |
---|
Name: | Tumor necrosis factor |
Synonyms: | Cachectin | TNF | TNF-a | TNF-alpha | TNFA | TNFA_HUMAN | TNFSF2 | Tumor necrosis factor (TNF-alpha) | Tumor necrosis factor (TNFa) | Tumor necrosis factor alpha (TNFα) | Tumor necrosis factor ligand superfamily member 2 | Tumor necrosis factor, membrane form | Tumor necrosis factor, soluble form | tumor necrosis factor alpha |
Type: | Enzyme |
Mol. Mass.: | 25645.11 |
Organism: | Homo sapiens (Human) |
Description: | P01375 |
Residue: | 233 |
Sequence: | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
|
|
|
BDBM50373071 |
---|
n/a |
---|
Name | BDBM50373071 |
Synonyms: | CHEMBL255489 |
Type | Small organic molecule |
Emp. Form. | C32H32F3N3O2 |
Mol. Mass. | 547.6106 |
SMILES | CN(CCN(C)Cc1coc2cc(C)c(C)cc2c1=O)Cc1cn(-c2cccc(c2)C(F)(F)F)c2ccccc12 |
Structure |
|