Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50023216 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1368488 (CHEMBL3300408) |
---|
Ki | 2.4±n/a nM |
---|
Citation | Laurini, E; Harel, D; Marson, D; Schepmann, D; Schmidt, TJ; Pricl, S; Wünsch, B Identification, pharmacological evaluation and binding mode analysis of novel chromene and chromane baseds1 receptor ligands. Eur J Med Chem83:526-33 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50023216 |
---|
n/a |
---|
Name | BDBM50023216 |
Synonyms: | CHEMBL2435435 |
Type | Small organic molecule |
Emp. Form. | C21H31NO2 |
Mol. Mass. | 329.4763 |
SMILES | COc1cc2OC(C)(C)C=Cc2cc1C(C)NCC1CCCCC1 |c:9| |
Structure |
|