| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A1 |
|---|
| Ligand | BDBM50080550 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1438086 (CHEMBL3387887) |
|---|
| Ki | 11000000±n/a nM |
|---|
| Citation |  Romagnoli, R; Baraldi, PG; IJzerman, AP; Massink, A; Cruz-Lopez, O; Lopez-Cara, LC; Saponaro, G; Preti, D; Aghazadeh Tabrizi, M; Baraldi, S; Moorman, AR; Vincenzi, F; Borea, PA; Varani, K Synthesis and biological evaluation of novel allosteric enhancers of the A1 adenosine receptor based on 2-amino-3-(4'-chlorobenzoyl)-4-substituted-5-arylethynyl thiophene. J Med Chem57:7673-86 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A1 |
|---|
| Name: | Adenosine receptor A1 |
|---|
| Synonyms: | AA1R_RAT | ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptor | Adenosine receptors A1 | Adora1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 36704.13 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | n/a |
|---|
| Residue: | 326 |
|---|
| Sequence: | MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
|
|
|
|---|
| BDBM50080550 |
|---|
| n/a |
|---|
| Name | BDBM50080550 |
|---|
| Synonyms: | (2-Amino-4,5-dimethyl-thiophen-3-yl)-(3-trifluoromethyl-phenyl)-methanone | (2-amino-4,5-dimethyl-3-thienyl)-[3-(trifluoromethyl)phenyl]methanone | (2-amino-4,5-dimethylthien-3-yl)-[3-(trifluoromethyl)phenyl]-methanone | (2-amino-4,5-dimethylthiophen-3-yl)(3-(trifluoromethyl)phenyl)methanone | CHEMBL59532 | PD-81723 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H12F3NOS |
|---|
| Mol. Mass. | 299.311 |
|---|
| SMILES | Cc1sc(N)c(C(=O)c2cccc(c2)C(F)(F)F)c1C |
|---|
| Structure | 
|
|---|
Search and Browse
