Reaction Details |
| Report a problem with these data |
Target | Cytosol aminopeptidase [33-68,L62W] |
---|
Ligand | BDBM50129684 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1442056 (CHEMBL3373424) |
---|
Ki | 66±n/a nM |
---|
Citation | Vassiliou, S; Weglarz-Tomczak, E; Berlicki, L; Pawelczak, M; Nocek, B; Mulligan, R; Joachimiak, A; Mucha, A Structure-guided, single-point modifications in the phosphinic dipeptide structure yield highly potent and selective inhibitors of neutral aminopeptidases. J Med Chem57:8140-51 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cytosol aminopeptidase [33-68,L62W] |
---|
Name: | Cytosol aminopeptidase [33-68,L62W] |
Synonyms: | AMPL_PIG | Cytosol aminopeptidase | LAP3 | Leucine aminopeptidase (LAP) |
Type: | Enzyme |
Mol. Mass.: | 4015.44 |
Organism: | Sus scrofa (Pig) |
Description: | P28839[33-68,L62W] |
Residue: | 36 |
Sequence: | TKGLVLGIYSKEKEDDAPQFTSAGENFDKWVSGKLR
|
|
|
BDBM50129684 |
---|
n/a |
---|
Name | BDBM50129684 |
Synonyms: | 3-[(1-amino-3-phenyl-propyl)-hydroxy-phosphinoyl]-2-benzyl-propionic acid | CHEMBL327844 |
Type | Small organic molecule |
Emp. Form. | C19H24NO4P |
Mol. Mass. | 361.3719 |
SMILES | OC(=O)C(Cc1ccccc1)CP(O)(O)C(=N)CCc1ccccc1 |
Structure |
|