Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E synthase |
---|
Ligand | BDBM50099413 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1439894 (CHEMBL3388594) |
---|
IC50 | 59±n/a nM |
---|
Citation | Banerjee, A; Pawar, MY; Patil, S; Yadav, PS; Kadam, PA; Kattige, VG; Deshpande, DS; Pednekar, PV; Pisat, MK; Gharat, LA Development of 2-aryl substituted quinazolin-4(3H)-one, pyrido[4,3-d]pyrimidin-4(3H)-one and pyrido[2,3-d]pyrimidin-4(3H)-one derivatives as microsomal prostaglandin E(2) synthase-1 inhibitors. Bioorg Med Chem Lett24:4838-44 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E synthase |
---|
Name: | Prostaglandin E synthase |
Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
Type: | Protein |
Mol. Mass.: | 17112.22 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 152 |
Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
BDBM50099413 |
---|
n/a |
---|
Name | BDBM50099413 |
Synonyms: | CHEMBL3342846 |
Type | Small organic molecule |
Emp. Form. | C27H31Cl2N5O3 |
Mol. Mass. | 544.473 |
SMILES | CC(C)C(=O)NCc1ccc(Cl)c(c1)-c1nc2cc(Cl)c(cc2c(=O)[nH]1)N1CC(C1)C(=O)NC(C)(C)C |
Structure |
|