Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBcl-2-like protein 1
LigandBDBM50030751
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1437735
Ki 0.330000±n/a nM
Citation Tao ZFHasvold LWang LWang XPetros AMPark CHBoghaert ERCatron NDChen JColman PMCzabotar PEDeshayes KFairbrother WJFlygare JAHymowitz SGJin SJudge RAKoehler MFKovar PJLessene GMitten MJNdubaku CONimmer PPurkey HEOleksijew APhillips DCSleebs BESmith BJSmith MLTahir SKWatson KGXiao YXue JZhang HZobel KRosenberg SHTse CLeverson JDElmore SWSouers AJ Discovery of a Potent and Selective BCL-XL Inhibitor with in Vivo Activity. ACS Med Chem Lett 5:1088-93 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bcl-2-like protein 1
Name:Bcl-2-like protein 1
Synonyms:Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | BCL2-like 1 isoform 1 | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD)
Type:Mitochondrion membrane; Single-pass membrane protein
Mol. Mass.:26039.60
Organism:Homo sapiens (Human)
Description:n/a
Residue:233
Sequence:
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50030751
n/a
NameBDBM50030751
Synonyms:CHEMBL3342334
TypeSmall organic molecule
Emp. Form.C35H31F2N5O4S2
Mol. Mass.687.779
SMILESCN(C)CC#Cc1cc(F)c(OCCCc2sc(nc2C(O)=O)N2CCc3cccc(C(=O)Nc4nc5ccccc5s4)c3C2)cc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: