Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase VA
LigandBDBM50429900
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1441637
Kd 290±n/a nM
Citation Dudutiene VMatuliene JSmirnov ATimm DDZubriene ABaranauskiene LMorkunaite VSmirnoviene JMichailoviene VJuozapaitiene VMickeviciute AKazokaite JBak?yte SKasiliauskaite AJachno JRevuckiene JKi?onaite MPilipuityte VIvanauskaite EMilinaviciute GSmirnovas VPetrikaite VKairys VPetrauskas VNorvai?as PLinge DGibie?a PCapkauskaite EZak?auskas AKazlauskas EManakova EGra?ulis SLadbury JEMatulis D Discovery and characterization of novel selective inhibitors of carbonic anhydrase IX. J Med Chem 57:9435-46 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase VA
Name:Carbonic anhydrase V
Synonyms:CA-VA | Carbonate dehydratase VA | Carbonic anhydrase 5A (CA VA) | Carbonic anhydrase 5A, mitochondrial | Carbonic anhydrase 5A, mitochondrial precursor | Carbonic anhydrase VA (CA VA)
Type:Enzyme
Mol. Mass.:34755.54
Organism:Homo sapiens (Human)
Description:Human (cloned) isozyme
Residue:305
Sequence:
MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPG
GTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPL
ENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVI
GVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLT
ESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATN
EGTRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50429900
n/a
NameBDBM50429900
Synonyms:CHEMBL2333417
TypeSmall organic molecule
Emp. Form.C8H7F4NO5S2
Mol. Mass.337.268
SMILESNS(=O)(=O)c1c(F)c(F)c(c(F)c1F)S(=O)(=O)CCO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: