Reaction Details |
| Report a problem with these data |
Target | Jak1 protein |
---|
Ligand | BDBM103727 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1433491 (CHEMBL3382761) |
---|
IC50 | 29±n/a nM |
---|
Citation | Menet, CJ; Fletcher, SR; Van Lommen, G; Geney, R; Blanc, J; Smits, K; Jouannigot, N; Deprez, P; van der Aar, EM; Clement-Lacroix, P; Lepescheux, L; Galien, R; Vayssiere, B; Nelles, L; Christophe, T; Brys, R; Uhring, M; Ciesielski, F; Van Rompaey, L Triazolopyridines as selective JAK1 inhibitors: from hit identification to GLPG0634. J Med Chem57:9323-42 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Jak1 protein |
---|
Name: | Jak1 protein |
Synonyms: | Jak1 | Jak1 protein |
Type: | PROTEIN |
Mol. Mass.: | 24213.75 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_109515 |
Residue: | 210 |
Sequence: | MEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAIQICKGMDYLGSRQYVHRDL
AARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDV
WSFGVTLHELLTYCDSDFSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLSCPPNCPDEV
YQLMRKCWEFQPSNRTTFQNLIEGFEALLK
|
|
|
BDBM103727 |
---|
n/a |
---|
Name | BDBM103727 |
Synonyms: | US10112907, Example 00033 | US10206907, Compound 200 | US10708263, Compound 1 | US10766894, Compound TABLE 1.18 | US10919890, Compound 1 | US10961228, Example Filgotinib | US11000528, Cpd # 1 | US11203595, TABLE 1.18 | US11279699, Compound Filgotinib | US8563545, 1 |
Type | Small organic molecule |
Emp. Form. | C21H23N5O3S |
Mol. Mass. | 425.504 |
SMILES | O=C(Nc1nc2cccc(-c3ccc(CN4CCS(=O)(=O)CC4)cc3)n2n1)C1CC1 |
Structure |
|