Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50034090 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1437207 (CHEMBL3382981) |
---|
Ki | 1.1±n/a nM |
---|
Citation | Lan, Y; Chen, Y; Cao, X; Zhang, J; Wang, J; Xu, X; Qiu, Y; Zhang, T; Liu, X; Liu, BF; Zhang, G Synthesis and biological evaluation of novel sigma-1 receptor antagonists based on pyrimidine scaffold as agents for treating neuropathic pain. J Med Chem57:10404-23 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50034090 |
---|
n/a |
---|
Name | BDBM50034090 |
Synonyms: | CHEMBL3359239 |
Type | Small organic molecule |
Emp. Form. | C19H23Cl2N3O |
Mol. Mass. | 380.311 |
SMILES | Cc1nc(nc(OCCCN2CCCCC2)c1Cl)-c1ccc(Cl)cc1 |
Structure |
|