Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 6 (CA-VI)
LigandBDBM10880
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1443936
Ki 11±n/a nM
Citation Ceruso MAntel SVullo DScozzafava ASupuran CT Inhibition studies of new ureido-substituted sulfonamides incorporating a GABA moiety against human carbonic anhydrase isoforms I-XIV. Bioorg Med Chem 22:6768-75 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 6 (CA-VI)
Name:Carbonic anhydrase 6 (CA-VI)
Synonyms:CA-VI | Carbonate dehydratase VI | Carbonic Anhydrase VI | Carbonic anhydrase 6 | Carbonic anhydrase 6 (CA VI) | Carbonic anhydrase VI (CA VI) | Salivary carbonic anhydrase | Secreted carbonic anhydrase
Type:Enzyme
Mol. Mass.:35371.40
Organism:Homo sapiens (Human)
Description:P23280
Residue:308
Sequence:
MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYN
PSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSE
ISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNF
ISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLS
RTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEIL
DYLRRALN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10880
n/a
NameBDBM10880
Synonyms:AZA | AZA2 | AZM acetazolamide | Acerazolamide, AAZ | Acetazolamide | Acetazolamide (AAZ) | Acetazolamide (AZA) | Acetazolamide (AZM) | Acetazolamide, 5 | Acetazolamide, AAZ | Acetazolamide, AZA | Acetazolamide, AZM | CHEMBL20 | N-(5-sulfamoyl-1,3,4-thiadiazol-2-yl)acetamide | Sulfonamide, 1 | US10172837, Acetazolamide | sulfonamide 1
TypeSmall organic molecule
Emp. Form.C4H6N4O3S2
Mol. Mass.222.245
SMILESCC(=O)Nc1nnc(s1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: