Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Sgk1
LigandBDBM50043018
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1444807
IC50<1.2±n/a nM
Citation Rosse G Novel azaindazole sulfonamides inhibitors of serum and glucocorticoid regulated kinase. ACS Med Chem Lett 6:19-20 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase Sgk1
Name:Serine/threonine-protein kinase Sgk1
Synonyms:SGK1 | Serine/threonine-protein kinase Sgk1 | Serine/threonine-protein kinase Sgk1 (SGK) | Serum/glucocorticoid regulated kinase | Serum/glucocorticoid-regulated kinase 1 (SGK1)
Type:Other Protein Type
Mol. Mass.:48954.40
Organism:Homo sapiens (Human)
Description:Recombinant human SGK-1 enzyme produced in a baculovirus system.
Residue:431
Sequence:
MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKI
SQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE
EVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYIN
GGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTD
FGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSR
NTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINW
DDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLG
FSYAPPTDSFL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50043018
n/a
NameBDBM50043018
Synonyms:CHEMBL3355028 | US9718825, Example 63
TypeSmall organic molecule
Emp. Form.C20H18Cl2N6O3S
Mol. Mass.493.366
SMILESNCCCOc1nc(nc2[nH]ncc12)-c1ccc(NS(=O)(=O)c2cc(Cl)ccc2Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: