| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase FKBP1B |
|---|
| Ligand | BDBM36609 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1458980 (CHEMBL3369573) |
|---|
| Kd | 0.200000±n/a nM |
|---|
| Citation |  Gibbs, AC Elements and modulation of functional dynamics. J Med Chem57:7819-37 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase FKBP1B |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase FKBP1B |
|---|
| Synonyms: | 12.6 kDa FKBP | FK506-binding protein 1B | FKB1B_HUMAN | FKBP-12.6 | FKBP-1B | FKBP12.6 | FKBP1B | FKBP1L | FKBP9 | Immunophilin FKBP12.6 | OTK4 | PPIase FKBP1B | Peptidyl-prolyl cis-trans isomerase FKBP1B | Rotamase | h-FKBP-12 | mTOR/FKBP12A/FKBP12B |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 11785.40 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1458980 |
|---|
| Residue: | 108 |
|---|
| Sequence: | MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGF
EEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
|
|
|
|---|
| BDBM36609 |
|---|
| n/a |
|---|
| Name | BDBM36609 |
|---|
| Synonyms: | Rapamycin C-7, analog 4 | SIROLIMUS | US11603377, Compound Ramycin |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C51H79NO13 |
|---|
| Mol. Mass. | 914.1719 |
|---|
| SMILES | CO[C@@H]1C[C@H](C[C@@H](C)[C@@H]2CC(=O)[C@H](C)\C=C(C)\[C@@H](O)[C@@H](OC)C(=O)[C@H](C)C[C@H](C)\C=C\C=C\C=C(C)\[C@H](C[C@@H]3CC[C@@H](C)[C@@](O)(O3)C(=O)C(=O)N3CCCC[C@H]3C(=O)O2)OC)CC[C@H]1O |c:14,33,t:29,31| |
|---|
| Structure | 
|
|---|
Search and Browse
