Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin B
LigandBDBM50286441
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1459871
Ki 13±n/a nM
Citation Raghav NSingh M SAR studies of differently functionalized chalcones based hydrazones and their cyclized derivatives as inhibitors of mammalian cathepsin B and cathepsin H. Bioorg Med Chem 22:4233-45 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin B
Name:Cathepsin B
Synonyms:n/a
Type:Protein
Mol. Mass.:36777.57
Organism:Capra hircus (Goat)
Description:n/a
Residue:335
Sequence:
MWQLLATLSCLLVLTSARSSLHFPPLSDEMVNYVNKQNTTWKAGHNFYNVDLSYVKKLCG
AILGGPKLPQRDAFAADMVLPDSFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDR
ICIHSKGRVNVEVSAEDMLTCCGSECGDGCNGGFPSGAWNFWTKKGLVSGGLYDSHVGCR
PYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPSYKDDKHFGCSSYSVSSNEKEIM
AEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEMMGGHAIRILGWGVENDTPYWLVGNSW
NTDWGDKGFFKILRGQDHCGIESEIVAGMPCTHQY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50286441
n/a
NameBDBM50286441
Synonyms:(S)-2-((S)-2-Acetylamino-4-(S)-methyl-pentanoylamino)-4-methyl-pentanoic acid (1-formyl-4-guanidino-butyl)-amide | (S)-2-Acetylamino-4-methyl-pentanoic acid [(R)-1-((S)-1-formyl-4-guanidino-butylcarbamoyl)-3-methyl-butyl]-amide | (S)-2-Acetylamino-4-methyl-pentanoic acid [(S)-1-((S)-1-formyl-4-guanidino-butylcarbamoyl)-3-methyl-butyl]-amide | (S)-2-[(S)-2-((S)-2-Acetylamino-4-methyl-pentanoylamino)-4-methyl-pentanoylamino]-5-guanidino-pentanoic acid | (S)-2-acetylamino-4-methyl-pentanoic acid [(S)-2-(1-formyl-4-guanidino-butylamino)-4-methyl-pentanoyl]-amide | 2-Acetylamino-4-methyl-pentanoic acid [1-(1-formyl-4-guanidino-butylcarbamoyl)-3-methyl-butyl]-amide | Ac-LLR-CHO | Ac-Leu-Leu-Arg-H | CHEMBL129157
TypeSmall organic molecule
Emp. Form.C20H38N6O5
Mol. Mass.442.5529
SMILESCC(C)C[C@H](NC(C)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: