Reaction Details |
| Report a problem with these data |
Target | Toxin ParE |
---|
Ligand | BDBM50047324 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1454591 (CHEMBL3366703) |
---|
IC50 | 190±n/a nM |
---|
Citation | Basarab, GS; Hill, PJ; Garner, CE; Hull, K; Green, O; Sherer, BA; Dangel, PB; Manchester, JI; Bist, S; Hauck, S; Zhou, F; Uria-Nickelsen, M; Illingworth, R; Alm, R; Rooney, M; Eakin, AE Optimization of pyrrolamide topoisomerase II inhibitors toward identification of an antibacterial clinical candidate (AZD5099). J Med Chem57:6060-82 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Toxin ParE |
---|
Name: | Toxin ParE |
Synonyms: | Gyrase inhibitor ParE | PARE_ECOLX | Toxin ParE | parE |
Type: | PROTEIN |
Mol. Mass.: | 11720.14 |
Organism: | Escherichia coli |
Description: | ChEMBL_109450 |
Residue: | 103 |
Sequence: | MTAYILTAEAEADLRGIIRYTRREWGAAQVRRYIAKLEQGIARLAAGEGPFKDMSELFPA
LRMARCEHHYVFCLPRAGEPALVVAILHERMDLMTRLADRLKG
|
|
|
BDBM50047324 |
---|
n/a |
---|
Name | BDBM50047324 |
Synonyms: | CHEMBL3314533 |
Type | Small organic molecule |
Emp. Form. | C18H22Cl2N4O5S |
Mol. Mass. | 477.362 |
SMILES | COCCO[C@H]1CN(CC[C@H]1NC(=O)c1[nH]c(C)c(Cl)c1Cl)c1ncc(s1)C(O)=O |r| |
Structure |
|