| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Toxin ParE |
|---|
| Ligand | BDBM50047312 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1454591 (CHEMBL3366703) |
|---|
| IC50 | 120±n/a nM |
|---|
| Citation |  Basarab, GS; Hill, PJ; Garner, CE; Hull, K; Green, O; Sherer, BA; Dangel, PB; Manchester, JI; Bist, S; Hauck, S; Zhou, F; Uria-Nickelsen, M; Illingworth, R; Alm, R; Rooney, M; Eakin, AE Optimization of pyrrolamide topoisomerase II inhibitors toward identification of an antibacterial clinical candidate (AZD5099). J Med Chem57:6060-82 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Toxin ParE |
|---|
| Name: | Toxin ParE |
|---|
| Synonyms: | Gyrase inhibitor ParE | PARE_ECOLX | Toxin ParE | parE |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 11720.14 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | ChEMBL_109450 |
|---|
| Residue: | 103 |
|---|
| Sequence: | MTAYILTAEAEADLRGIIRYTRREWGAAQVRRYIAKLEQGIARLAAGEGPFKDMSELFPA
LRMARCEHHYVFCLPRAGEPALVVAILHERMDLMTRLADRLKG
|
|
|
|---|
| BDBM50047312 |
|---|
| n/a |
|---|
| Name | BDBM50047312 |
|---|
| Synonyms: | CHEMBL3313938 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H20Cl2N6O4S |
|---|
| Mol. Mass. | 511.382 |
|---|
| SMILES | CO[C@H]1CN(CC[C@H]1NC(=O)c1[nH]c(C)c(Cl)c1Cl)c1nc(c(s1)C(O)=O)-c1cncnc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
