Reaction Details |
| Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50058936 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1460986 (CHEMBL3394961) |
---|
Ki | 96000±n/a nM |
---|
Citation | Ung, PM; Dunbar, JB; Gestwicki, JE; Carlson, HA An allosteric modulator of HIV-1 protease shows equipotent inhibition of wild-type and drug-resistant proteases. J Med Chem57:6468-78 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50058936 |
---|
n/a |
---|
Name | BDBM50058936 |
Synonyms: | CHEMBL3393116 |
Type | Small organic molecule |
Emp. Form. | C15H7N3O4S2 |
Mol. Mass. | 357.364 |
SMILES | [O-][N+](=O)c1cccc2C(=O)N(C(=O)c12)c1ccc2[nH]c(=S)sc2c1 |
Structure |
|