Reaction Details |
| Report a problem with these data |
Target | Protein tyrosine phosphatase type IVA 3 |
---|
Ligand | BDBM50059086 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1461022 (CHEMBL3395080) |
---|
IC50 | 47800±n/a nM |
---|
Citation | Hoeger, B; Diether, M; Ballester, PJ; Köhn, M Biochemical evaluation of virtual screening methods reveals a cell-active inhibitor of the cancer-promoting phosphatases of regenerating liver. Eur J Med Chem88:89-100 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protein tyrosine phosphatase type IVA 3 |
---|
Name: | Protein tyrosine phosphatase type IVA 3 |
Synonyms: | PRL3 | PTP4A3 | Protein-tyrosine phosphatase 4A3 | TP4A3_HUMAN |
Type: | PROTEIN |
Mol. Mass.: | 19546.22 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1461022 |
Residue: | 173 |
Sequence: | MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEK
DGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALI
ESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM
|
|
|
BDBM50059086 |
---|
n/a |
---|
Name | BDBM50059086 |
Synonyms: | CHEMBL3393146 |
Type | Small organic molecule |
Emp. Form. | C13H10BrNO3 |
Mol. Mass. | 308.127 |
SMILES | Oc1ccc(\C=C(/C#N)C(=O)OCC=C)cc1Br |
Structure |
|