| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein tyrosine phosphatase type IVA 3 |
|---|
| Ligand | BDBM50059139 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1461022 (CHEMBL3395080) |
|---|
| IC50 | 102000±n/a nM |
|---|
| Citation |  Hoeger, B; Diether, M; Ballester, PJ; Köhn, M Biochemical evaluation of virtual screening methods reveals a cell-active inhibitor of the cancer-promoting phosphatases of regenerating liver. Eur J Med Chem88:89-100 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein tyrosine phosphatase type IVA 3 |
|---|
| Name: | Protein tyrosine phosphatase type IVA 3 |
|---|
| Synonyms: | PRL3 | PTP4A3 | Protein-tyrosine phosphatase 4A3 | TP4A3_HUMAN |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 19546.22 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1461022 |
|---|
| Residue: | 173 |
|---|
| Sequence: | MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEK
DGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALI
ESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM
|
|
|
|---|
| BDBM50059139 |
|---|
| n/a |
|---|
| Name | BDBM50059139 |
|---|
| Synonyms: | CHEMBL3393147 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H9NO3S |
|---|
| Mol. Mass. | 271.291 |
|---|
| SMILES | OC(=O)c1ccc[n+]2c([O-])c(sc12)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
