Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone-lysine N-methyltransferase SUV39H1
LigandBDBM50063670
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1463678
IC50 9500±n/a nM
Citation Kung PPHuang BZehnder LTatlock JBingham PKrivacic CGajiwala KDiehl WYu XMaegley KA SAH derived potent and selective EZH2 inhibitors. Bioorg Med Chem Lett 25:1532-7 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone-lysine N-methyltransferase SUV39H1
Name:Histone-lysine N-methyltransferase SUV39H1
Synonyms:H3-K9-HMTase 1 | Histone H3-K9 methyltransferase 1 | KMT1A | Lysine N-methyltransferase 1A | Position-effect variegation 3-9 homolog | SUV39H | SUV39H1 | Su(var)3-9 homolog 1 | Suppressor of variegation 3-9 homolog 1
Type:PROTEIN
Mol. Mass.:47917.07
Organism:Homo sapiens (Human)
Description:ChEMBL_1473655
Residue:412
Sequence:
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50063670
n/a
NameBDBM50063670
Synonyms:CHEMBL3397332
TypeSmall organic molecule
Emp. Form.C24H29N9O4S
Mol. Mass.539.61
SMILESN[C@@H](CCSC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(N)ncnc12)C(=O)NCc1cc([nH]n1)-c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: