Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSET and MYND domain-containing protein 2 (SMYD2)
LigandBDBM50063670
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1463681
IC50>100000±n/a nM
Citation Kung PPHuang BZehnder LTatlock JBingham PKrivacic CGajiwala KDiehl WYu XMaegley KA SAH derived potent and selective EZH2 inhibitors. Bioorg Med Chem Lett 25:1532-7 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
SET and MYND domain-containing protein 2 (SMYD2)
Name:N-lysine methyltransferase SMYD2
Synonyms:HSKM-B | Histone methyltransferase SMYD2 | KMT3C | Lysine N-methyltransferase 3C | N-lysine methyltransferase SMYD2 | SET and MYND domain-containing protein 2 | SMYD2
Type:Enzyme
Mol. Mass.:49689.57
Organism:Homo sapiens (Human)
Description:Q9NRG4
Residue:433
Sequence:
MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKE
GLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHP
ERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVN
CNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSY
IDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARN
VIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGAL
QYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDH
PYISEIKQEIESH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50063670
n/a
NameBDBM50063670
Synonyms:CHEMBL3397332
TypeSmall organic molecule
Emp. Form.C24H29N9O4S
Mol. Mass.539.61
SMILESN[C@@H](CCSC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(N)ncnc12)C(=O)NCc1cc([nH]n1)-c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: