Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-Phosphate Receptor 2
LigandBDBM149711
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1463952
IC50 1200±n/a nM
Citation Kusumi KShinozaki KKanaji TKurata HNaganawa AOtsuki KMatsushita TSekiguchi TKakuuchi ASeko T Discovery of novel S1P2 antagonists. Part 1: discovery of 1,3-bis(aryloxy)benzene derivatives. Bioorg Med Chem Lett 25:1479-82 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-Phosphate Receptor 2
Name:Sphingosine 1-phosphate receptor Edg-5/Sphingosine 1-phosphate receptor Edg-3
Synonyms:S1P2 | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-5 | Sphingosine-1-phosphate receptor 2 | ndothelial differentiation G-protein coupled receptor 5
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:38883.16
Organism:Homo sapiens (Human)
Description:Membranes isolated from S1P2-transfected CHO cells were used in ligand binding assay.
Residue:353
Sequence:
MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM149711
n/a
NameBDBM149711
Synonyms:US8975409, Comparative compound B
TypeSmall organic molecule
Emp. Form.C24H31FN2O3
Mol. Mass.414.5129
SMILESCCC(CC)CC1(O)CCN(CC1)C(=O)Nc1cccc(Oc2ccc(F)cc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: