Reaction Details |
| Report a problem with these data |
Target | Interleukin-5 |
---|
Ligand | BDBM50242276 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1464308 (CHEMBL3404575) |
---|
IC50 | 10600±n/a nM |
---|
Citation | Venkateswararao, E; Manickam, M; Boggu, P; Kim, Y; Jung, SH Exploration of benzamidochromenone derivatives with conformational restrictor as interleukin-5 inhibitors. Bioorg Med Chem23:2498-504 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Interleukin-5 |
---|
Name: | Interleukin-5 |
Synonyms: | IL5_MOUSE | Il-5 | Il5 |
Type: | PROTEIN |
Mol. Mass.: | 15414.97 |
Organism: | Mus musculus |
Description: | ChEMBL_1464308 |
Residue: | 133 |
Sequence: | MRRMLLHLSVLTLSCVWATAMEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQ
LCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQE
FLGVMSTEWAMEG
|
|
|
BDBM50242276 |
---|
n/a |
---|
Name | BDBM50242276 |
Synonyms: | CHEMBL486626 | Sophoricoside |
Type | Small organic molecule |
Emp. Form. | C21H20O10 |
Mol. Mass. | 432.3775 |
SMILES | OC[C@H]1O[C@@H](Oc2ccc(cc2)-c2coc3cc(O)cc(O)c3c2=O)[C@H](O)[C@@H](O)[C@@H]1O |r| |
Structure |
|