| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase |
|---|
| Ligand | BDBM13076 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1466707 (CHEMBL3404500) |
|---|
| Ki | 32±n/a nM |
|---|
| Citation |  Syrjänen, L; Kuuslahti, M; Tolvanen, M; Vullo, D; Parkkila, S; Supuran, CT Theß-carbonic anhydrase from the malaria mosquito Anopheles gambiae is highly inhibited by sulfonamides. Bioorg Med Chem23:2303-9 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase |
|---|
| Name: | Carbonic anhydrase |
|---|
| Synonyms: | Carbonate dehydratase | Carbonic anhydrase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 29919.95 |
|---|
| Organism: | Anopheles gambiae |
|---|
| Description: | ChEMBL_109570 |
|---|
| Residue: | 255 |
|---|
| Sequence: | MERILRGVMRYRHTTREQMVQEFRKVRDNPQPKAVFFTCMDSRMIPTRFTETHVGDMFVV
RNAGNLVPHAEHFQDEYFSCEPAALELGCVVNNIKHIIVCGHSDCKAMNLLYKLKDPEFA
SLDNRRISPLRAWLCEHANTSLAKFQNLKEIGLDKPLIFSSETPLRKFVAYIDPENNFAI
EDKLSQVNTLQQIENVASYGFLKRRLESHDLHIHALWFDIYTGDIYFFSRNSKRFIAIDE
SSIDRLLDEVRRYYS
|
|
|
|---|
| BDBM13076 |
|---|
| n/a |
|---|
| Name | BDBM13076 |
|---|
| Synonyms: | 6-chloro-1,1-dioxo-3,4-dihydro-2H-1,2,4-benzothiadiazine-7-sulfonamide | BMCL182567 Compound 6a | Dichlothiazide | Hydro-D | Hydrochlorothiazide | Hypothiazide | JFD00715 | Oretic | cid_3639 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C7H8ClN3O4S2 |
|---|
| Mol. Mass. | 297.739 |
|---|
| SMILES | NS(=O)(=O)c1cc2c(NCNS2(=O)=O)cc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
