| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50073588 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1467413 (CHEMBL3411697) |
|---|
| Ki | 0.870000±n/a nM |
|---|
| Citation |  Banister, SD; Beinat, C; Wilkinson, SM; Shen, B; Bartoli, C; Selleri, S; Da Pozzo, E; Martini, C; Chin, FT; Kassiou, M Ether analogues of DPA-714 with subnanomolar affinity for the translocator protein (TSPO). Eur J Med Chem93:392-400 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18834.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30536 |
|---|
| Residue: | 169 |
|---|
| Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
|---|
| BDBM50073588 |
|---|
| n/a |
|---|
| Name | BDBM50073588 |
|---|
| Synonyms: | CHEMBL3408974 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H25FN2O |
|---|
| Mol. Mass. | 316.413 |
|---|
| SMILES | CCN(CC)C(=O)[C@H]1CCCc2c1c1ccccc1n2CCF |r| |
|---|
| Structure | 
|
|---|
Search and Browse
