Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFalcipain-2
LigandBDBM50074132
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1468093
Ki 300±n/a nM
Citation Chakka SKKalamuddin MSundararaman SWei LMundra SMahesh RMalhotra PMohmmed AKotra LP Identification of novel class of falcipain-2 inhibitors as potential antimalarial agents. Bioorg Med Chem 23:2221-40 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Falcipain-2
Name:Falcipain 2
Synonyms:Cysteine protease falcipain-2 | Falcipain 2
Type:Enzyme
Mol. Mass.:55912.60
Organism:Plasmodium falciparum
Description:Recombinant falcipain-2.
Residue:484
Sequence:
MDYNMDYAPHEVISQQGERFVDKYVDRKILKNKKSLLVIISLSVLSVVGFVLFYFTPNSR
KSDLFKNSSVENNNDDYIINSLLKSPNGKKFIVSKIDEALSFYDSKKNDINKYNEGNNNN
NADFKGLSLFKENTPSNNFIHNKDYFINFFDNKFLMNNAEHINQFYMFIKTNNKQYNSPN
EMKERFQVFLQNAHKVNMHNNNKNSLYKKELNRFADLTYHEFKNKYLSLRSSKPLKNSKY
LLDQMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAI
RKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNID
RCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVM
LVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFI
PLIE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50074132
n/a
NameBDBM50074132
Synonyms:CHEMBL3409913
TypeSmall organic molecule
Emp. Form.C39H57N5O6
Mol. Mass.691.8998
SMILESCOc1ccc(OC[C@@H]2CCCN2C(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)N2CCCCC2)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: