Reaction Details |
| Report a problem with these data |
Target | Aldo-keto reductase family 1 member B1 |
---|
Ligand | BDBM50134036 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1473106 (CHEMBL3421435) |
---|
IC50 | 77000±n/a nM |
---|
Citation | Maccari, R; Ottaną, R Targeting aldose reductase for the treatment of diabetes complications and inflammatory diseases: new insights and future directions. J Med Chem58:2047-67 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Aldo-keto reductase family 1 member B1 |
---|
Name: | Aldo-keto reductase family 1 member B1 |
Synonyms: | AKR1B1 | ALDR1 | ALDR_HUMAN | ALR2 | AR | Aldo-keto reductase family 1 member B1 (AKR1B1) | Aldose Reductase (ALR2) | Aldose reductase | Aldose reductase (AR) |
Type: | Protein |
Mol. Mass.: | 35855.50 |
Organism: | Homo sapiens (Human) |
Description: | P15121. 4LAU; 2IKI; 4LB4; 2FZD; 2FZ8; 1US0 |
Residue: | 316 |
Sequence: | MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF
|
|
|
BDBM50134036 |
---|
n/a |
---|
Name | BDBM50134036 |
Synonyms: | 2-(2,3-Dimethyl-phenylamino)-benzoic acid | 2-(2,3-Dimethyl-phenylamino)-benzoic acid(Mefenamic acid) | 2-(2,3-dimethylphenylamino)benzoic acid | CHEMBL686 | CI-473 | CN-35355 | INF-3355 | MEFENAMIC ACID | Ponstel | cid_4044 | mefanamic acid |
Type | Small organic molecule |
Emp. Form. | C15H15NO2 |
Mol. Mass. | 241.2851 |
SMILES | Cc1cccc(Nc2ccccc2C(O)=O)c1C |
Structure |
|