Reaction Details |
| Report a problem with these data |
Target | Aldo-keto reductase family 1 member B10 |
---|
Ligand | BDBM50134036 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1473105 (CHEMBL3421434) |
---|
IC50 | 1600±n/a nM |
---|
Citation | Maccari, R; Ottaną, R Targeting aldose reductase for the treatment of diabetes complications and inflammatory diseases: new insights and future directions. J Med Chem58:2047-67 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Aldo-keto reductase family 1 member B10 |
---|
Name: | Aldo-keto reductase family 1 member B10 |
Synonyms: | AK1BA_HUMAN | AKR1B10 | AKR1B11 | ARL-1 | ARP | Aldo-keto reductase family 1 member B10 | Aldo-keto reductase family 1 member B10 (AKR1B10) | Aldo-keto reductase family member 1B10 (AKR1B10) | Aldose reductase-like | Aldose reductase-related protein | SI reductase | Small intestine reductase | hARP |
Type: | Protein |
Mol. Mass.: | 36024.67 |
Organism: | Homo sapiens (Human) |
Description: | O60218. 1ZUA; 4JII; 4GQ0 |
Residue: | 316 |
Sequence: | MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQ
EKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGD
DLFPKDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKP
VTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAK
HKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATILSFNRNWRACN
VLQSSHLEDYPFNAEY
|
|
|
BDBM50134036 |
---|
n/a |
---|
Name | BDBM50134036 |
Synonyms: | 2-(2,3-Dimethyl-phenylamino)-benzoic acid | 2-(2,3-Dimethyl-phenylamino)-benzoic acid(Mefenamic acid) | 2-(2,3-dimethylphenylamino)benzoic acid | CHEMBL686 | CI-473 | CN-35355 | INF-3355 | MEFENAMIC ACID | Ponstel | cid_4044 | mefanamic acid |
Type | Small organic molecule |
Emp. Form. | C15H15NO2 |
Mol. Mass. | 241.2851 |
SMILES | Cc1cccc(Nc2ccccc2C(O)=O)c1C |
Structure |
|