Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 3
LigandBDBM50027084
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1475222
EC50 0.350000±n/a nM
Citation Doering SRTodorovic AHaskell-Luevano C Melanocortin antagonist tetrapeptides with minimal agonist activity at the mouse melanocortin-3 receptor. ACS Med Chem Lett 6:123-7 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 3
Name:Melanocortin receptor 3
Synonyms:MC3-R
Type:PROTEIN
Mol. Mass.:35808.24
Organism:Mus musculus
Description:ChEMBL_1498848
Residue:323
Sequence:
MNSSCCLSSVSPMLPNLSEHPAAPPASNRSGSGFCEQVFIKPEVFLALGIVSLMENILVI
LAVVRNGNLHSPMYFFLCSLAAADMLVSLSNSLETIMIAVINSDSLTLEDQFIQHMDNIF
DSMICISLVASICNLLAIAIDRYVTIFYALRYHSIMTVRKALTLIGVIWVCCGICGVMFI
IYSESKMVIVCLITMFFAMVLLMGTLYIHMFLFARLHVQRIAVLPPAGVVAPQQHSCMKG
AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA
FRSLELRNTFKEILCGCNSMNLG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50027084
n/a
NameBDBM50027084
Synonyms:MELATONAN | Melatonan
TypeSmall organic molecule
Emp. Form.C50H69N15O9
Mol. Mass.1024.178
SMILESCCCC[C@H](NC(C)=O)C(=O)N[C@H]1CC(=O)NCCCC[C@H](NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](Cc2ccccc2)NC(=O)[C@H](Cc2cnc[nH]2)NC1=O)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: