Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPatatin-like phospholipase domain-containing protein 2
LigandBDBM50084925
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1476694
IC50>200000±n/a nM
Citation Mayer NSchweiger MMelcher MCFledelius CZechner RZimmermann RBreinbauer R Structure-activity studies in the development of a hydrazone based inhibitor of adipose-triglyceride lipase (ATGL). Bioorg Med Chem 23:2904-16 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Patatin-like phospholipase domain-containing protein 2
Name:Patatin-like phospholipase domain-containing protein 2
Synonyms:Adipose triglyceride lipase | Atgl | Desnutrin | Patatin-like phospholipase domain-containing protein 2 | Pnpla2
Type:PROTEIN
Mol. Mass.:53655.79
Organism:Mus musculus
Description:ChEMBL_109612
Residue:486
Sequence:
MFPRETKWNISFAGCGFLGVYHIGVASCLREHAPFLVANATHIYGASAGALTATALVTGA
CLGEAGANIIEVSKEARKRFLGPLHPSFNLVKTIRGCLLKTLPADCHERANGRLGISLTR
VSDGENVIISHFSSKDELIQANVCSTFIPVYCGLIPPTLQGVRYVDGGISDNLPLYELKN
TITVSPFSGESDICPQDSSTNIHELRVTNTSIQFNLRNLYRLSKALFPPEPMVLREMCKQ
GYRDGLRFLRRNGLLNQPNPLLALPPVVPQEEDAEEAAVVEERAGEEDQLQPYRKDRILE
HLPARLNEALLEACVEPKDLMTTLSNMLPVRLATAMMVPYTLPLESAVSFTIRLLEWLPD
VPEDIRWMKEQTGSICQYLVMRAKRKLGDHLPSRLSEQVELRRAQSLPSVPLSCATYSEA
LPNWVRNNLSLGDALAKWEECQRQLLLGLFCTNVAFPPDALRMRAPASPTAADPATPQDP
PGLPPC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50084925
n/a
NameBDBM50084925
Synonyms:CHEMBL3427362
TypeSmall organic molecule
Emp. Form.C18H21N3O2
Mol. Mass.311.3782
SMILESOc1ccc(\C=N\N2CCCN(CC2)c2ccccc2)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: