Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSolute carrier organic anion transporter family member 1B1 (OATP1B1)
LigandBDBM50088491
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1494637
IC50 8500±n/a nM
Citation Köck KXie YHawke RLOberlies NHBrouwer KL Interaction of silymarin flavonolignans with organic anion-transporting polypeptides. Drug Metab Dispos 41:958-65 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Solute carrier organic anion transporter family member 1B1 (OATP1B1)
Name:Solute carrier organic anion transporter family member 1B1 (OATP1B1)
Synonyms:Solute carrier organic anion transporter family member 1B1 | Thromboxane B2
Type:Protein
Mol. Mass.:76468.06
Organism:Homo sapiens (Human)
Description:Q9Y6L6
Residue:691
Sequence:
MDQNQHLNKTAEAQPSENKKTRYCNGLKMFLAALSLSFIAKTLGAIIMKSSIIHIERRFE
ISSSLVGFIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCFIMGIGGVLTALPHFFMGY
YRYSKETNINSSENSTSTLSTCLINQILSLNRASPEIVGKGCLKESGSYMWIYVFMGNML
RGIGETPIVPLGLSYIDDFAKEGHSSLYLGILNAIAMIGPIIGFTLGSLFSKMYVDIGYV
DLSTIRITPTDSRWVGAWWLNFLVSGLFSIISSIPFFFLPQTPNKPQKERKASLSLHVLE
TNDEKDQTANLTNQGKNITKNVTGFFQSFKSILTNPLYVMFVLLTLLQVSSYIGAFTYVF
KYVEQQYGQPSSKANILLGVITIPIFASGMFLGGYIIKKFKLNTVGIAKFSCFTAVMSLS
FYLLYFFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGIT
YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAI
QVLNLFFSALGGTSHVMLIVKIVQPELKSLALGFHSMVIRALGGILAPIYFGALIDTTCI
KWSTNNCGTRGSCRTYNSTSFSRVYLGLSSMLRVSSLVLYIILIYAMKKKYQEKDINASE
NGSVMDEANLESLNKNKHFVPSAGADSETHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50088491
n/a
NameBDBM50088491
Synonyms:SILYBIN B | Silybin B
TypeSmall organic molecule
Emp. Form.C25H22O10
Mol. Mass.482.4362
SMILESCOc1cc(ccc1O)[C@@H]1Oc2cc(ccc2O[C@H]1CO)[C@H]1Oc2cc(O)cc(O)c2C(=O)[C@@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: