Reaction Details |
| Report a problem with these data |
Target | Sulfotransferase 1A1 |
---|
Ligand | BDBM50187243 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1484211 (CHEMBL3537872) |
---|
Kd | 4.3±n/a nM |
---|
Citation | Rohn, KJ; Cook, IT; Leyh, TS; Kadlubar, SA; Falany, CN Potent inhibition of human sulfotransferase 1A1 by 17a-ethinylestradiol: role of 3'-phosphoadenosine 5'-phosphosulfate binding and structural rearrangements in regulating inhibition and activity. Drug Metab Dispos40:1588-95 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sulfotransferase 1A1 |
---|
Name: | Sulfotransferase 1A1 |
Synonyms: | Aryl sulfotransferase 1 | HAST1/HAST2 | P-PST 1 | Phenol sulfotransferase 1 | Phenol-sulfating phenol sulfotransferase 1 | ST1A1 | ST1A1_HUMAN | ST1A3 | STP | STP | STP1 | SULT1A1 | Sulfotransferase 1A1 | Sulfotransferase 1A1 (SULT1A1) | Thermostable phenol sulfotransferase | Ts-PST |
Type: | Enzyme |
Mol. Mass.: | 34165.45 |
Organism: | Homo sapiens (Human) |
Description: | P50225 |
Residue: | 295 |
Sequence: | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDM
IYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLD
QKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWW
ELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNY
TTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
|
|
|
BDBM50187243 |
---|
n/a |
---|
Name | BDBM50187243 |
Synonyms: | 17-ethinyl-3,17-estradiol | 17-ethinyl-3,17-oestradiol | 17-ethinylestradiol | 17alpha-Ethinyl estradiol | 17alpha-ethynylestra-1,3,5(10)-triene-3,17beta-diol | 17alpha-ethynylestradiol | CHEMBL691 | ETHINYL ESTRADIOL | Ethinylestradiol | Ethynyl estradiol | ethinyloestradiol |
Type | Small organic molecule |
Emp. Form. | C20H24O2 |
Mol. Mass. | 296.4034 |
SMILES | C[C@]12CC[C@H]3[C@@H](CCc4cc(O)ccc34)[C@@H]1CC[C@@]2(O)C#C |r| |
Structure |
|