| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP2 subtype |
|---|
| Ligand | BDBM50092615 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1501401 (CHEMBL3588430) |
|---|
| IC50 | 8.0±n/a nM |
|---|
| Citation |  Fox, BM; Beck, HP; Roveto, PM; Kayser, F; Cheng, Q; Dou, H; Williamson, T; Treanor, J; Liu, H; Jin, L; Xu, G; Ma, J; Wang, S; Olson, SH A selective prostaglandin E2 receptor subtype 2 (EP2) antagonist increases the macrophage-mediated clearance of amyloid-beta plaques. J Med Chem58:5256-73 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor EP2 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP2 subtype |
|---|
| Synonyms: | PE2R2_HUMAN | PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP4 subtype | Prostanoid EP2 Receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39775.71 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P43116 |
|---|
| Residue: | 358 |
|---|
| Sequence: | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
|
|
|
|---|
| BDBM50092615 |
|---|
| n/a |
|---|
| Name | BDBM50092615 |
|---|
| Synonyms: | CHEMBL3586361 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H21ClN2O2S |
|---|
| Mol. Mass. | 436.954 |
|---|
| SMILES | C[C@@H]1COc2c(Cl)cc(cc2CN1Cc1cc[nH]c(=O)c1)-c1csc2ccccc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
