| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Ligand | BDBM50096252 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1506094 (CHEMBL3595960) |
|---|
| Ki | 47000±n/a nM |
|---|
| Citation |  Fonseca, EM; Trivella, DB; Scorsato, V; Dias, MP; Bazzo, NL; Mandapati, KR; de Oliveira, FL; Ferreira-Halder, CV; Pilli, RA; Miranda, PC; Aparicio, R Crystal structures of the apo form and a complex of human LMW-PTP with a phosphonic acid provide new evidence of a secondary site potentially related to the anchorage of natural substrates. Bioorg Med Chem23:4462-71 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Name: | Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Synonyms: | Acp1 | LMW-PTP | LMW-PTPase | Low molecular weight cytosolic acid phosphatase | Low molecular weight phosphotyrosine protein phosphatase | PPAC_MOUSE |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18192.04 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_109834 |
|---|
| Residue: | 158 |
|---|
| Sequence: | MAEVGSKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWRIDSAATSTYEVGNPPDYRG
QNCMRKHGIHMQHIARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY
|
|
|
|---|
| BDBM50096252 |
|---|
| n/a |
|---|
| Name | BDBM50096252 |
|---|
| Synonyms: | CHEMBL3594198 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C8H10ClO3P |
|---|
| Mol. Mass. | 220.59 |
|---|
| SMILES | OP(O)(=O)Cc1ccc(CCl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
