Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual-specificity tyrosine-phosphorylation regulated kinase 3
LigandBDBM50097868
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1502251
IC50>100000±n/a nM
Citation Falke HChaikuad ABecker ALoac NLozach OAbu Jhaisha SBecker WJones PGPreu LBaumann KKnapp SMeijer LKunick C 10-iodo-11H-indolo[3,2-c]quinoline-6-carboxylic acids are selective inhibitors of DYRK1A. J Med Chem 58:3131-43 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual-specificity tyrosine-phosphorylation regulated kinase 3
Name:Dual-specificity tyrosine-phosphorylation regulated kinase 3
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:65747.26
Organism:Homo sapiens (Human)
Description:ChEMBL_1508026
Residue:588
Sequence:
MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPR
RLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKS
SDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHG
VIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMV
RNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIK
KNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSC
FEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLAC
MMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGS
KDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKR
VVNPASAFQGLGSKLPPVVGIANKLKANLMSETNGSIPLCSVLPKLIS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50097868
n/a
NameBDBM50097868
Synonyms:CHEMBL3589661
TypeSmall organic molecule
Emp. Form.C16H9BrN2O2
Mol. Mass.341.159
SMILESOC(=O)c1nc2ccccc2c2[nH]c3c(Br)cccc3c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: