Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual-specificity tyrosine-phosphorylation regulated kinase 1A
LigandBDBM50097869
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1502241
IC50 6.0±n/a nM
Citation Falke HChaikuad ABecker ALoac NLozach OAbu Jhaisha SBecker WJones PGPreu LBaumann KKnapp SMeijer LKunick C 10-iodo-11H-indolo[3,2-c]quinoline-6-carboxylic acids are selective inhibitors of DYRK1A. J Med Chem 58:3131-43 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual-specificity tyrosine-phosphorylation regulated kinase 1A
Name:Dual-specificity tyrosine-phosphorylation regulated kinase 1A
Synonyms:DYRK1A | Dual specificity YAK1-related kinase | Dual specificity YAK1-related kinase 1A (Dyrk1A) | Dual specificity tyrosine-phosphorylation-regulated kinase 1A (DYRK1A) | Dual-specificity tyrosine-regulated kinases 1A | HP86
Type:Enzyme
Mol. Mass.:85616.61
Organism:Homo sapiens (Human)
Description:Q13627
Residue:763
Sequence:
MHTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMPHSHQYSDRRQPNISDQQVSALSYSD
QIQQPLTNQVMPDIVMLQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQ
QGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRV
EQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEM
LSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKR
SAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPL
FSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWNLKKTKDGKREYKPPGT
RKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFK
KTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGG
HFTAAVQAMDCETHSPQVRQQFPAPLGWSGTEAPTQVTVETHPVQETTFHVAPQQNALHH
HHGNSSHHHHHHHHHHHHHGQQALGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSS
STTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTY
QFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50097869
n/a
NameBDBM50097869
Synonyms:CHEMBL3589662
TypeSmall organic molecule
Emp. Form.C16H9IN2O2
Mol. Mass.388.1593
SMILESOC(=O)c1nc2ccccc2c2[nH]c3c(I)cccc3c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: