| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Retinol-binding protein 4 |
|---|
| Ligand | BDBM50104179 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1505277 (CHEMBL3594967) |
|---|
| IC50 | 4.1±n/a nM |
|---|
| Citation |  Cioffi, CL; Racz, B; Freeman, EE; Conlon, MP; Chen, P; Stafford, DG; Schwarz, DM; Zhu, L; Kitchen, DB; Barnes, KD; Dobri, N; Michelotti, E; Cywin, CL; Martin, WH; Pearson, PG; Johnson, G; Petrukhin, K Bicyclic [3.3.0]-Octahydrocyclopenta[c]pyrrolo Antagonists of Retinol Binding Protein 4: Potential Treatment of Atrophic Age-Related Macular Degeneration and Stargardt Disease. J Med Chem58:5863-88 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Retinol-binding protein 4 |
|---|
| Name: | Retinol-binding protein 4 |
|---|
| Synonyms: | PRBP | Plasma retinol-binding protein | RBP | RBP4 | RET4_HUMAN | Retinol-binding protein 4 | Retinol-binding protein 4 (RBP4) | spa binding assay for rbp4 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 23008.75 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P02753 |
|---|
| Residue: | 201 |
|---|
| Sequence: | MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIV
AEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGND
DHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLA
RQYRLIVHNGYCDGRSERNLL
|
|
|
|---|
| BDBM50104179 |
|---|
| n/a |
|---|
| Name | BDBM50104179 |
|---|
| Synonyms: | CHEMBL3594225 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H20F3N3O2 |
|---|
| Mol. Mass. | 379.3762 |
|---|
| SMILES | COC(=O)c1cc(C)nc(n1)N1CCC(CC1)c1ccccc1C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
