Reaction Details |
| Report a problem with these data |
Target | Adenosine receptor A1 |
---|
Ligand | BDBM50080550 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1514828 (CHEMBL3615340) |
---|
Ki | 11000±n/a nM |
---|
Citation | Romagnoli, R; Baraldi, PG; Lopez-Cara, C; Cruz-Lopez, O; Moorman, AR; Massink, A; IJzerman, AP; Vincenzi, F; Borea, PA; Varani, K Synthesis and biological evaluation of a new series of 2-amino-3-aroyl thiophene derivatives as agonist allosteric modulators of the A1 adenosine receptor. A position-dependent effect study. Eur J Med Chem101:185-204 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenosine receptor A1 |
---|
Name: | Adenosine receptor A1 |
Synonyms: | AA1R_RAT | ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptor | Adenosine receptors A1 | Adora1 |
Type: | Protein |
Mol. Mass.: | 36704.13 |
Organism: | Rattus norvegicus (rat) |
Description: | n/a |
Residue: | 326 |
Sequence: | MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
|
|
|
BDBM50080550 |
---|
n/a |
---|
Name | BDBM50080550 |
Synonyms: | (2-Amino-4,5-dimethyl-thiophen-3-yl)-(3-trifluoromethyl-phenyl)-methanone | (2-amino-4,5-dimethyl-3-thienyl)-[3-(trifluoromethyl)phenyl]methanone | (2-amino-4,5-dimethylthien-3-yl)-[3-(trifluoromethyl)phenyl]-methanone | (2-amino-4,5-dimethylthiophen-3-yl)(3-(trifluoromethyl)phenyl)methanone | CHEMBL59532 | PD-81723 |
Type | Small organic molecule |
Emp. Form. | C14H12F3NOS |
Mol. Mass. | 299.311 |
SMILES | Cc1sc(N)c(C(=O)c2cccc(c2)C(F)(F)F)c1C |
Structure |
|