Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50117202 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1514011 (CHEMBL3616197) |
---|
Ki | 130±n/a nM |
---|
Citation | Damont, A; Marguet, F; Puech, F; Dollé, F Synthesis and in vitro characterization of novel fluorinated derivatives of the TSPO 18 kDa ligand SSR180575. Eur J Med Chem101:736-45 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50117202 |
---|
n/a |
---|
Name | BDBM50117202 |
Synonyms: | CHEMBL3613371 |
Type | Small organic molecule |
Emp. Form. | C24H24ClFN4O3 |
Mol. Mass. | 470.924 |
SMILES | CN(C)C(=O)Cc1nn(-c2ccccc2)c(=O)c2n(CCOCCF)c3cc(Cl)ccc3c12 |
Structure |
|