Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLIM domain kinase 1
LigandBDBM50117502
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1514397
IC50 23±n/a nM
Citation Boland SBourin AAlen JGeraets JSchroeders PCastermans KKindt NBoumans NPanitti LVanormelingen JFransen SVan de Velde SDefert O Design, synthesis and biological characterization of selective LIMK inhibitors. Bioorg Med Chem Lett 25:4005-10 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
LIM domain kinase 1
Name:LIM domain kinase 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:72591.81
Organism:Homo sapiens (Human)
Description:gi_4505001
Residue:647
Sequence:
MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLS
HQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGD
GDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSV
SIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEID
LLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSID
RSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRE
TGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGT
LRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFG
LARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLC
EIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKL
EHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50117502
n/a
NameBDBM50117502
Synonyms:CHEMBL3613622
TypeSmall organic molecule
Emp. Form.C24H30N6O3
Mol. Mass.450.5334
SMILESCOC(=O)c1cccc(NC(=O)C2(CN(C)C)CCN(CC2)c2ncnc3[nH]c(C)cc23)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: