Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 2
LigandBDBM50005711
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1518391
IC50 25±n/a nM
Citation Muthyala RShin WSXie JSham YY Discovery of 1-hydroxypyridine-2-thiones as selective histone deacetylase inhibitors and their potential application for treating leukemia. Bioorg Med Chem Lett 25:4320-4 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 2
Name:Histone deacetylase 2
Synonyms:HD2 | HDAC2 | Histone deacetylase 2 (HDAC2) | Human HDAC2
Type:Chromatin regulator; hydrolase; repressor
Mol. Mass.:55356.54
Organism:Homo sapiens (Human)
Description:The assay was performed using isolated HDAC2 that had been expressed as full-length 6x His-tagged fusion proteins in a baculovirus expression system in Sf9 cells.
Residue:488
Sequence:
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGT
KSEQLSNP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005711
n/a
NameBDBM50005711
Synonyms:CHEBI:46024 | GNF-Pf-1011 | TRICHOSTATIN | Trichostatin A | Trichostatin A (TSA) | US9265734, TSA
TypeSmall organic molecule
Emp. Form.C17H22N2O3
Mol. Mass.302.3682
SMILESC[C@H](\C=C(/C)\C=C\C(=O)NO)C(=O)c1ccc(cc1)N(C)C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: