Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFlap endonuclease 1
LigandBDBM50157846
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1517026
IC50 57±n/a nM
Citation Chapman TMWallace CGillen KJBakrania PKhurana PCoombs PJFox SBureau EABrownlees JMelton DWSaxty B N-Hydroxyimides and hydroxypyrimidinones as inhibitors of the DNA repair complex ERCC1-XPF. Bioorg Med Chem Lett 25:4104-8 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Flap endonuclease 1
Name:Flap endonuclease 1
Synonyms:DNase IV | FEN-1 | FEN1 | Flap structure-specific endonuclease 1 | MF1 | Maturation factor 1 | RAD2 | hFEN-1
Type:PROTEIN
Mol. Mass.:42602.57
Organism:Homo sapiens (Human)
Description:ChEMBL_1517026
Residue:380
Sequence:
MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGET
TSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAE
QEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDM
DCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRG
IGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSE
PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEP
KGSTKKKAKTGAAGKFKRGK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50157846
n/a
NameBDBM50157846
Synonyms:3-Hydroxy-7-p-tolyl-1H-furo[3,2-d]pyrimidine-2,4-dione | CHEMBL182381
TypeSmall organic molecule
Emp. Form.C13H10N2O4
Mol. Mass.258.2295
SMILESCc1ccc(cc1)-c1coc2c1[nH]c(=O)n(O)c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: