| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sodium channel protein type 1 subunit alpha [1489-1708] |
|---|
| Ligand | BDBM50117271 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1525517 (CHEMBL3636870) |
|---|
| IC50 | 21000±n/a nM |
|---|
| Citation |  Suzuki, S; Kuroda, T; Kimoto, H; Domon, Y; Kubota, K; Kitano, Y; Yokoyama, T; Shimizugawa, A; Sugita, R; Koishi, R; Asano, D; Tamaki, K; Shinozuka, T; Kobayashi, H Discovery of (phenoxy-2-hydroxypropyl)piperidines as a novel class of voltage-gated sodium channel 1.7 inhibitors. Bioorg Med Chem Lett25:5419-23 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sodium channel protein type 1 subunit alpha [1489-1708] |
|---|
| Name: | Sodium channel protein type 1 subunit alpha [1489-1708] |
|---|
| Synonyms: | SCN1A_MOUSE | Scn1a | Voltage-gated sodium channel alpha subunit Nav1.1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 25514.04 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_109872 |
|---|
| Residue: | 220 |
|---|
| Sequence: | QKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKFQGMVFDFVTRQVFDISIM
ILICLNMVTMMVETDDQSDYVTSILSRINLVFIVLFTGECVLKLISLRHYYFTIGWNIFD
FVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLP
ALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFE
|
|
|
|---|
| BDBM50117271 |
|---|
| n/a |
|---|
| Name | BDBM50117271 |
|---|
| Synonyms: | 1-(2,6-dimethylphenoxy)-2-propanolamine | 1-(2,6-dimethylphenoxy)propan-2-amine | 2-(2,6-Dimethyl-phenoxy)-1-methyl-ethylamine | 2-(2,6-Dimethyl-phenoxy)-1-methyl-ethylamine(mexiletine) | CHEMBL558 | MEXILETINE | Mexitil |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H17NO |
|---|
| Mol. Mass. | 179.2588 |
|---|
| SMILES | CC(N)COc1c(C)cccc1C |
|---|
| Structure | 
|
|---|
Search and Browse
